PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000131822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 348aa    MW: 39333.4 Da    PI: 9.1474
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000131822genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-141663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +lv +++++G  +W++ ++  g+ R++k+c++rw +yl
    MDP0000131822 16 KGPWSPEEDHKLVAYIQRYGIWNWSRMPKPAGLARSGKSCRLRWVNYL 63
                     79******************99************************97 PP

2Myb_DNA-binding491.4e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++E+e ++++++  G++ W++Ia++++ gRt++++k++w++++
    MDP0000131822  69 RGNFGKDEEETILELHQAIGNR-WSAIAARLP-GRTDNEIKNYWHTHM 114
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8091163IPR017930Myb domain
SuperFamilySSF466896.36E-2914110IPR009057Homeodomain-like
SMARTSM007171.5E-81565IPR001005SANT/Myb domain
PfamPF002491.3E-121663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-221770IPR009057Homeodomain-like
CDDcd001674.93E-71863No hitNo description
PROSITE profilePS5129422.12764118IPR017930Myb domain
SMARTSM007171.0E-1468116IPR001005SANT/Myb domain
PfamPF002493.0E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2571117IPR009057Homeodomain-like
CDDcd001671.09E-871114No hitNo description
PfamPF045781.4E-5274307IPR007658Protein of unknown function DUF594
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAKRTQRCEK TVAVKKGPWS PEEDHKLVAY IQRYGIWNWS RMPKPAGLAR SGKSCRLRWV  60
NYLRPDIKRG NFGKDEEETI LELHQAIGNR WSAIAARLPG RTDNEIKNYW HTHMKKRFKA  120
GIESVHEEAK GSGDKEASKN KLSEAGQLFL VDEATKVASL KSEATCSASS SVYFPVWEFD  180
DQKGQIAEQS VCASDVTFGE LQSLDSQVWQ QEPIFPCDSY INHVTSDYWS SFVVFSDVSC  240
KWGSEVKPAA VKGDVSKSVL FDACILAKEL MKMKDKKWDM MSEVRMELLS STAGHCRAND  300
HAQLLSKXXR ACHLCLVTDG SFRHRGAVPN KRGPCKSKIH CRKVNSMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26161187108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159910.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744690.0DQ074469.1 Malus x domestica MYB21 mRNA, complete cds.
GenBankKC6912480.0KC691248.1 Malus x domestica MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008349268.11e-173PREDICTED: myb-related protein Myb4-like
TrEMBLQ2LME31e-173Q2LME3_MALDO; MYB transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.11e-55myb domain protein 74